Skip to Content

ELISA Recombinant Bovine Keratinocyte-associated protein 3(KRTCAP3)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:Q3SZ72 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MRCRRLCAFDAARGPRRLMRVGLALILVGHVNLLLGAVLHGTVLRHVANPRGAVTPEYTT ANVISVGSGLLSVSLGLVALLASRNLFRPRLHWALLALALVNLLLSAACSLGLLLAVSLT VANGGRRLIADCHPGLLDPLVPLDQGSGHADCPFDPTKIYDTALALWIPSVFMSAAEAAL SGYCCVAALTLRGVGPCRKDGLQEQLEELTELEFPKRKWQENVQLLDQTREIRTSQKSWV Protein Names:Recommended name: Keratinocyte-associated protein 3 Short name= KCP-3 Gene Names:Name:KRTCAP3 Expression Region:1-240 Sequence Info:fµLl length protein
1,00 € 1,00 €

Vilkår og betingelser
30 dages fuld returret
Forsendelse: 2-3 hverdage