Zum Inhalt springen

ELISA Recombinant Brucella abortus biovar 1 Probable intracellular septation protein A(BruAb1_1911)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Brucella abortus biovar 1 (strain 9-941) Uniprot NO.:Q57AW3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEHPVFERDPSEKSETERREVPPLLKLALELGPLLVFFFANARGEmLIERFPILGSIGAP IFLATALFMAATVIALAISWSMTRTLPIMPLVSGIVVLVFGALTLWLHNDTFIKMKPTIV NTLFGGILLGGLFFGKSLLGYVFDSAFRLDAEGWRKLTLRWGLFFIFLAIVNEIVWRNFS TDTWVSFKVWGIMPITIVFTLLQMPLIQKHSLTDEENTAS Protein Names:Recommended name: Probable intracellµLar septation protein A Gene Names:Ordered Locus Names:BruAb1_1911 Expression Region:1-220 Sequence Info:fµLl length protein
1,00 € 1,00 €

Allgemeine Geschäftsbedingungen
30-Tage-Geld-zurück-Garantie
Versand: 2-3 Geschäftstage