Zum Inhalt springen

ELISA Recombinant Brucella abortus biovar 1 Probable ABC transporter permease protein BruAb2_1124(BruAb2_1124)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Brucella abortus biovar 1 (strain 9-941) Uniprot NO.:Q576D9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNARLTGLGLNLLSFAVGIGGWYLLTATGAVVLPGPVDVLERAVTLLLNGQLVGDIFASL RRVLSGFVLGVALAIPVGFLMGWYRIARSLIEPWVQFFRMIPPLAVIPLAIVTLGIDESP KIFVIFLASFLSSVVATYQGVISVDRTLINAARVLGAKDATIFARVIVPASVPFILVGVR IGLGSAWATVVAAELIAAQSGLGYRMQQAQLYYDLPTIFVSLVTIGILGLFMDRLLQAAD RRLTQWQERA Protein Names:Recommended name: Probable ABC transporter permease protein BruAb2_1124 Gene Names:Ordered Locus Names:BruAb2_1124 Expression Region:1-250 Sequence Info:fµLl length protein
1.00 € 1.00 €

Allgemeine Geschäftsbedingungen
30-Tage-Geld-zurück-Garantie
Versand: 2-3 Geschäftstage