Skip to Content

ELISA Recombinant Bovine Protein YIPF6(YIPF6)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:A6QLC6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAEAVESPGDPGTTTPRPLFAGLSDISISQDIPVEGEITIPVRSRVREFDSSTLNESVQN TIMRDLKAVGKKFMHVLYPRKSNTLLRDWDLWGPLILCVTLALmLQRGSVDSEKDGGPQF AEVFVIVWFGAVTITLNSKLLGGNISFFQSLCVLGYCILPLTMAmLVCRLVLLAEPGPVN FMVRLFVVIIMFAWSIVASTAFLADSQPPNRKALAVYPVFLFYFVISWMILTFTPQ Protein Names:Recommended name: Protein YIPF6 Alternative name(s): YIP1 family member 6 Gene Names:Name:YIPF6 Expression Region:1-236 Sequence Info:FµLl length protein
1,00 € 1,00 €

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days