Skip to Content

ELISA Recombinant Bovine Inhibitor of nuclear factor kappa-B kinase-interacting protein(IKBIP)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:A2VE53 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSEVKSRKKSGTKGAPAEPGKRNEGGKSPEARGGGGRGWADPRTGVSLLSLGTCLGLAWF VFQQSEKFAKVENQYQLLKMETSEFQGLQSKISLISEKCQKSEAIIEQLKAFQIITHLKH LQEEIYEVKTWSSRISEKQDILNNNLTTVSQDVAKADQSTTSMAKDIGLKITTIKTDIRR MSGLVTDVTSLTDSVQELENKIEKVEKNTVKNIGDLLSSSIDRTAmLRKTASENSQRINS VKKILSELQGDFNKHTDRLLSLESDRAKVLKTVTFANDLKPKVYNLKKDFSRLEPLVNDL TLRIGRLVTDLQQREKEIAFLKEKISNLTTVRAEIKDMKDEIKHISDMD Protein Names:Recommended name: Inhibitor of nuclear factor kappa-B kinase-interacting protein Short name= I kappa-B kinase-interacting protein Short name= IKBKB-interacting protein Short name= IKK-interacting protein Gene Names:Name:IKBIP Synonyms:IKIP Expression Region:1-349 Sequence Info:fµLl length protein
1,00 € 1,00 €

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days