Ir al contenido

ELISA Recombinant Bovine Claudin-7(CLDN7)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:Q3B7N4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MANSGLQLLGFSMALLGWVGLVACTAIPQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTG MMSCKMYDSVLSLPAALQATRALMVVSLVLGFLATFVATMGMKCTNCGGDDKVKKARIAM TGGIIFILAGLAALIACSWYGHQIVSDFYNPLVPMNVKYEFGPAIFIGWAGSALVLLGGA LLSCSCPGSESKAGYRAPRSYPKPNSAKEYV Protein Names:Recommended name: Claudin-7 Gene Names:Name:CLDN7 Expression Region:1-211 Sequence Info:fµLl length protein
1,00 € 1,00 €

Términos y condiciones
Grantía de devolución de 30 días
Envío: 2-3 días laborables