Ir al contenido

ELISA Recombinant Brucella abortus biovar 1 Protein CrcB homolog 4(crcB4)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Brucella abortus biovar 1 (strain 9-941) Uniprot NO.:Q578U0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSVEASILVLVGGFIGGVMRFFLSGYVGRRIGETFPWGTFVVNVSGAFVIGTAAGLGARL GGIFSTTIFHEFIMVGLLGGYTTVSSFCLQSVNLmLDGEQRQALFNIVASALLCVLAVAA GYGGIMWIMEWPG Protein Names:Recommended name: Protein CrcB homolog 4 Gene Names:Name:crcB4 Ordered Locus Names:BruAb2_0415 Expression Region:1-133 Sequence Info:fµLl length protein
1.00 € 1.00 €

Términos y condiciones
Grantía de devolución de 30 días
Envío: 2-3 días hábiles