Siirry sisältöön

ELISA Recombinant Bovine Polymeric immunoglobulin receptor(R),partial

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 22-32 working days Research Topic: Others Uniprot ID: P81265 Gene Names: PIGR Organism: Bos taurus (Bovine) AA Sequence: ESRGLIKEQYEGRLALLTEPGNGTYTVILNQLTDQDTGFYWCVTDGDTRWISTVELKVVQGEPSLKVPKNVTAWLGEPLKLSCHFPCKFYSFEKYWCKWSNRGCSALPTQNDGPSQAFVSCDQNSQVVSLNLDTVTKEDEGWYWCGVKEGPRYGETAAVYVAVESRVKGSQGAKQVKAAPAGAAIQSRAGEIQNKALLDPS Expression Region: 399-599aa Sequence Info: Partial Source: Yeast Tag Info: N-terminal 6xHis-tagged MW: 24.1 kDa Alternative Name(s): Relevance: This receptor binds polymeric IgA and IgM at the basolateral surface of epithelial cells. The complex is then transported across the cell to be secreted at the apical surface. During this process a cleavage occurs that separates the ExtracellµLar domain (known as the secretory component) from the transmbrane segment. Reference: Cloning and characterization of two forms of bovine polymeric immunoglobµLin receptor cDNA.KµLseth M.A., Krajci P., Myklebost O., Rogne S.DNA Cell Biol. 14:251-256(1995) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer,50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
1,00 € 1,00 €

Ehdot ja edellytykset
30 päivän rahat takaisin takuu
Toimitus: 2-3 arkipäivää