Se rendre au contenu

ELISA Recombinant Brucella abortus UPF0283 membrane protein BAbS19_I09770 (BAbS19_I09770)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Brucella abortus (strain S19) Uniprot NO.:B2S5P5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSDKTPRKPTAFRLEQPARVSAASEQEEPRRPRAVKDLEQITPQADVFDLTDDEAAELEI LDPAFEAPERKGWSLSRILFGALGILVSFAIGIWTEDLIRALFARADWLGWTALGVAMVA LAAFAAIILRELVALRRLASVQHLRKDAADAAERDDMAAARKAVDALRTIAAGIPETAKG RQLLDSLTDDIIDGRDLIRLAETEILRPLDREARTLVLNASKRVSIVTAISPRALVDIGY VIFESTRLIRRLSQLYGGRPGTLGFIKFARRVIAHLAVTGTIAMGDSVIQQLVGHGLASR LSAKLGEGVVNGLMTARIGIAAMDVVRPFPFNAEKRPGIGDFIGDLARLNSDRNARK Protein Names:Recommended name: UPF0283 membrane protein BAbS19_I09770 Gene Names:Ordered Locus Names:BAbS19_I09770 Expression Region:1-357 Sequence Info:fµLl length protein
1.00 € 1.00 €

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Livraison : 2-3 jours ouvrables