ELISA Recombinant Bovine UPF0767 protein C1orf212 homolog

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:A5PJ82 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MWPVLWTVVRTYAPYVTFPVAFVVGAVGYHLEWFIRGKEPQPVEEEKSISERREDRKLDE LLGKDHTQVVSLKDKLEFAPKAVLNRNRPEKN Protein Names:Recommended name: UPF0767 protein C1orf212 homolog Gene Names: Expression Region:1-92 Sequence Info:fµLl length protein