ELISA Recombinant Brucella abortus Lectin-like protein BA14k (BAbS19_II04750)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Brucella abortus (strain S19) Uniprot NO.:B2SAT5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:APMNMDRPAINQNVIQARAHYRPQNYNRGHRPGYWHGHRGYRHYRHGYRRHNDGWWYPLA AFGAGAIIGGAISQPRPVYRAPAGSPHVQWCYSRYKSYRASDNTFQPYNGPRKQCRSPYS R Protein Names:Recommended name: Lectin-like protein BA14k Gene Names:Ordered Locus Names:BAbS19_II04750 Expression Region:27-147 Sequence Info:fµLl length protein