ELISA Recombinant Brucella abortus Protein MgtC(mgtC)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Brucella abortus (strain 2308) Uniprot NO.:Q2YIG0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVWKPLAHTAACLAGAFLLGGLIGFERQFRHRLAGLRTNTLVAVGAATFVVFSSLVSGDS SPTRVAAQIVSGIGFLGAGIIFKEGFNVRGLNTAATLWCSAAVGVLCGAGLISHAAVATV FIIAVNALLRPLVQVLEFQAMRRGAFQPTYAIDIICHGDAEAQVRALLLRDIGDHLHIHE LESSNIEGTNRVEVSATVRADQRQDRLLEQIVGHLSLEPRITSARWRIEDDSGGLSGL Protein Names:Recommended name: Protein MgtC Gene Names:Name:mgtC Ordered Locus Names:BAB2_0039 Expression Region:1-238 Sequence Info:fµLl length protein