Skip to Content

ELISA Recombinant Bovine 3-oxo-5-alpha-steroid 4-dehydrogenase 1(SRD5A1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:A5PJS2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MELAERFLLDALAYLECALGVVCYVLLKLVGSPYGRYASSGSAFGLPARAAWTVQELPSL ALPLLACAGAGAPAERLNRWPNCILLAMFLVHYAQRSLVFPFLIRGGKPMPLYAFLLAFI FCTYNGYLQSRYLSQYAVYADDWLSDPRFLTGSALWLIGmLINIHSDHVLRNLRKPGETG YKIPRGGLFEYISAANYFGEVVEWCGYALASWSIQGWAFAVFTFCVLFTRAQQHHKWYHE KFEDYPKFRKIMIPFLV Protein Names:Recommended name: 3-oxo-5-alpha-steroid 4-dehydrogenase 1 EC= 1.3.99.5 Alternative name(s): SR type 1 Steroid 5-alpha-reductase 1 Short name= S5AR 1 Gene Names:Name:SRD5A1 Expression Region:1-257 Sequence Info:FµLl length protein
1.00 € 1.00 €

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days