Skip to Content

ELISA Recombinant Bovine Protein YIPF7(YIPF7)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:A5D7K7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSNLGQFDSDFYQSNYTIDNQEQTCNDSNACGNLYGSRKQQASEQPQPAFVPAEmLASSG YSGQFFQPASNQDYYSPSSYIDSFEEEPPLLEELGINFDHIWQKTLTVLNPMKPADGSIM NETDLTGPILFCMALGATLLLAGKVQFGYVYGMSAIGCLGIHALLNLMSSSGVSYGCVAS VLGYCLLPMVILSSCAIFFSLQGTFGTVSALVIIGWCSLSASKIFTSALAMEGQQLLIAY PCALLYGLFALVTVF Protein Names:Recommended name: Protein YIPF7 Alternative name(s): YIP1 family member 7 Gene Names:Name:YIPF7 Expression Region:1-255 Sequence Info:FµLl length protein
1.00 € 1.00 €

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days