Skip to Content

ELISA Recombinant Bovine Mesoderm-specific transcript homolog protein(MEST)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:Q2HJM9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVRRDRLRRMREWWVQVGLLAVPLLAAYLHIPPPQLSPALHSWKSSGKFFTYKGLRIFYQ DSVGVVGSPEIVVLLHGFPTSSYDWYKIWEGLTLSFHRVIALDFLGFGFSDKPRPHHYSI FEQASIVEALLRHLGLQSRRINLLSHDYGDTVAQELLYRFKQNRSGRLTIKSLCLSNGGI FPETHRPLLLQKLLKDGGmLSPILTRLMNFFVFSRGLTPVFGPYTRPSESELWDMWAGIR NNDGNLVIDSLLQYINQRKKFRRRWVGALASVSIPIHFIYGPLDPVNPYPEFLELYRKTL PRSTVSILDDHISHYPQLEDPMGFLNAYMGFINSF Protein Names:Recommended name: Mesoderm-specific transcript homolog protein EC= 3.-.-.- Alternative name(s): Paternally-expressed gene 1 protein Gene Names:Name:MEST Synonyms:PEG1 Expression Region:1-335 Sequence Info:fµLl length protein
1.00 € 1.00 €

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days