Skip to Content

ELISA Recombinant Brucella abortus Type IV secretion system protein virB8(virB8)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Brucella abortus (strain 2308) Uniprot NO.:Q2YJ78 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MFGRKQSPQKSVKNGQGNAPSVYDEALNWEAAHVRLVEKSERRAWKIAGAFGTITVLLGI GIAGmLPLKQHVPYLVRVNAQTGAPDILTSLDEKSVSYDTVMDKYWLSQYVIARETYDWY TLQKDYETVGmLSSPSEGQSYASQFQGDKALDKQYGSNVRTSVTIVSIVPNGKGIGTVRF AKTTKRTNETGDGETTHWIATIGYQYVNPSLMSESARLTNPLGFNVTSYRVDPEMGVVQ Protein Names:Recommended name: Type IV secretion system protein virB8 Gene Names:Name:virB8 Ordered Locus Names:BAB2_0061 Expression Region:1-239 Sequence Info:fµLl length protein
1.00 € 1.00 €

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days