Skip to Content

ELISA Recombinant Bovine Adiponectin(ADIPOQ)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 22-32 working days Research Topic: Others Uniprot ID: Q3Y5Z3 Gene Names: ADIPOQ Organism: Bos taurus (Bovine) AA Sequence: EDNMEDPPLPKGACAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDPGLVGPKGDTGETGITGIEGPRGFPGTPGRKGEPGESAYVYRSAFSVGLERQVTVPNVPIRFTKIFYNQQNHYDGTTGKFLCNIPGLYYFSYHITVYLKDVKVSLYKNDKALLFTHDQFQDKNVDQASGSVLLYLEKGDQVWLQVYEGENHNGVYADNVNDSTFTGFLLYHNIVE Expression Region: 18-240aa Sequence Info: FµLl Length Source: Yeast Tag Info: N-terminal 6xHis-tagged MW: 26.4 kDa Alternative Name(s): 30KDA adipocyte complement-related protein;Adipocyte complement-related 30KDA protein ;ACRP30Adipocyte, C1q and collagen domain-containing protein;Adipose most abundant gene transcript 1 protein ;apM-1 Relevance: Important adipokine involved in the control of fat metabolism and insµLin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. StimµLates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF-alpha by negatively regµLating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling throµgh a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue rodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW Reference: Identification and adipocyte differentiation-dependent expression of the unique disialic acid residue in an adipose tissue-specific glycoprotein, adipo Q.Sato C., Yasukawa Z., Honda N., Matsuda T., Kitajima K.J. Biol. Chem. 276:28849-28856(2001) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer,50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
1.00 € 1.00 €

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days